DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Eda

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001292172.1 Gene:Eda / 302424 RGDID:1563178 Length:391 Species:Rattus norvegicus


Alignment Length:151 Identity:42/151 - (27%)
Similarity:73/151 - (48%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 SEDSRPAAHFHLSSRRRHQGS-MGYHGDMYIG--NDNER---NSYQGHFQTRDGVLTVTNTGLYY 331
            :.:::||. .||..    ||| :....|:..|  ||..|   |........|.|.|.|...|.|:
  Rat   243 TRENQPAV-VHLQG----QGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYF 302

  Fly   332 VYAQ--ICYNNSHDQNGFIVFQGDTPFLQCLNTVPTNMPHKVHTCHTSGLIHLERNERIHLKDIH 394
            :|:|  :.|.|..|...:.|...:.|||||..::.|...: .:||:|:|:..|:..::|.:|.:|
  Rat   303 IYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTN-YNTCYTAGVCLLKARQKIAVKMVH 366

  Fly   395 NDRNAVLREGNNRSYFGIFKV 415
            .|.:  :....:.::||..::
  Rat   367 ADIS--INMSKHTTFFGAIRL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 42/142 (30%)
EdaNP_001292172.1 TNF 249..383 CDD:238108 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10800
eggNOG 1 0.900 - - E1_28MSH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto96981
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.