DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Tnfsf13

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_008766018.1 Gene:Tnfsf13 / 287437 RGDID:1305871 Length:257 Species:Rattus norvegicus


Alignment Length:200 Identity:39/200 - (19%)
Similarity:84/200 - (42%) Gaps:47/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 IADVRNEEQNIQ--GNHTELQEKSSNEATSKESPAPL--------HHRRRMHSRHRHLLVRKGES 267
            :..:|.|...:|  |..::.:.:...::..::||..|        ..|||.....:|   :|.:|
  Rat    46 LQSLRREVSRLQRSGGASQKRGEPPWQSLWEQSPDVLGAWKDGAKSRRRRAVLTQKH---KKKQS 107

  Fly   268 LLS------ARSEDSRPAAHFHLSSRRRHQGSMGYHGDMYIGNDNERNSYQGHFQTRDGVLTVTN 326
            :|.      ....||.........:.||.:|                      .:.:...:.|.:
  Rat   108 VLHLVPINITSKADSDMTEVMWQPALRRGRG----------------------LEAQGDTVRVRD 150

  Fly   327 TGLYYVYAQICYNNSHDQNGFIVF---QG--DTPFLQCLNTVPTNMPHKVHTCHTSGLIHLERNE 386
            ||:|.:|:|:.:::.....|.:|.   ||  :|.| :|:.::|::.....::|:::|:.||.:.:
  Rat   151 TGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLF-RCIKSMPSDPDRAYNSCYSAGVFHLHQGD 214

  Fly   387 RIHLK 391
            .|.:|
  Rat   215 IITVK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 22/118 (19%)
Tnfsf13XP_008766018.1 TNF 108..239 CDD:238108 25/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008250
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15151
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.