DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Tnfsf13b

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_296371.1 Gene:Tnfsf13b / 24099 MGIID:1344376 Length:309 Species:Mus musculus


Alignment Length:294 Identity:56/294 - (19%)
Similarity:109/294 - (37%) Gaps:93/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DMLN---KLNNAHTGTTPTS----ETTAEGEGETDSASSASNDDNVFDDFTSYNAHKKKQERKSR 211
            |::|   :|.:.....||.:    |.||..:..|.:|....|         |...|:.::.    
Mouse    76 DLMNLRMELQSYRGSATPAAAGAPELTAGVKLLTPAAPRPHN---------SSRGHRNRRA---- 127

  Fly   212 SIADVRNEEQNIQGNHTELQEKSSNEATSKESPAPLHHRRRMHSRH-------RHLLVRKGESLL 269
                       .||     .|::..:......|||.....| ||:|       |:::    :..|
Mouse   128 -----------FQG-----PEETEQDVDLSAPPAPCLPGCR-HSQHDDNGMNLRNII----QDCL 171

  Fly   270 SARSEDSRPAAH--------FHLSSRRRHQGSMGYHGDMYIGNDNERNSYQGHFQTRDGVLTVTN 326
            ...::...|...        :.||.:|              ||..|.         ::..:.|..
Mouse   172 QLIADSDTPTIRKGTYTFVPWLLSFKR--------------GNALEE---------KENKIVVRQ 213

  Fly   327 TGLYYVYAQICYNNSHDQNGFIVFQ------GD----TPFLQCLNTVPTNMPHKVHTCHTSGLIH 381
            ||.:::|:|:.|.:.....|.::.:      ||    ....:|:..:|..:|:  ::|:::|:..
Mouse   214 TGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPN--NSCYSAGIAR 276

  Fly   382 LERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
            ||..:.|.|. |..:...:.|.|:: ::||..|:
Mouse   277 LEEGDEIQLA-IPRENAQISRNGDD-TFFGALKL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 30/152 (20%)
Tnfsf13bNP_296371.1 GcrA <81..>155 CDD:264424 19/103 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..140 7/58 (12%)
TNF 170..306 CDD:238108 31/162 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.