DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Tnfsf12

DIOPT Version :10

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_035744.1 Gene:Tnfsf12 / 21944 MGIID:1196259 Length:249 Species:Mus musculus


Alignment Length:211 Identity:48/211 - (22%)
Similarity:82/211 - (38%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 QEKSSNEATSKESPAPLHHRRRMHSRH-----RHLLVRKGESLLSARSEDSRP----AAHFHLSS 286
            ||.|..|.|:::...|.....:.....     ...|||...|  :.:...:||    |||:.:..
Mouse    53 QEPSQEELTAEDRREPPELNPQTEESQDVVPFLEQLVRPRRS--APKGRKARPRRAIAAHYEVHP 115

  Fly   287 RRRHQGSM-GYHGDMYIGNDNERNSYQG-HFQTRDGVLTVTNTGLYYVYAQICYNNSHD------ 343
            |....|:. |..|.:....:.:.||... .:..:.|..||...||||:|.|:.::....      
Mouse   116 RPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLD 180

  Fly   344 --QNGFIVFQGDTPFLQCLN----TVPTNMPHKVHTCHTSGLIHLERNERIHLKDI---HNDRNA 399
              .||.:.       |:||.    |..::...::..|..|||:.|.....:.::.:   |     
Mouse   181 LLVNGVLA-------LRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAH----- 233

  Fly   400 VLREGNNRSYFGIFKV 415
             |:.....:|||:|:|
Mouse   234 -LKAAPFLTYFGLFQV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 35/155 (23%)
Tnfsf12NP_035744.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..78 6/24 (25%)
TNF 131..248 CDD:214557 28/129 (22%)

Return to query results.
Submit another query.