DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and EDA

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001390.1 Gene:EDA / 1896 HGNCID:3157 Length:391 Species:Homo sapiens


Alignment Length:462 Identity:87/462 - (18%)
Similarity:146/462 - (31%) Gaps:170/462 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GFPAKATSTATAQRRTRQLIPLVLGFIGLGLVVAILALTIWQTTRVSHLDKELKSLKRVVDNLQQ 83
            |.||:|....:..        |.|||.||.|.:.:|.|..:         .||:|..|.....:.
Human    29 GAPARAGEGNSCL--------LFLGFFGLSLALHLLTLCCY---------LELRSELRRERGAES 76

  Fly    84 RLGINYLDEFDEFQKEYENALIDYPKKVDGLTDEEDDDDGDG-------LDSIAD-DEDDDVSYS 140
            |||                                    |.|       |.|:.. |.|..::  
Human    77 RLG------------------------------------GSGTPGTSGTLSSLGGLDPDSPIT-- 103

  Fly   141 SVDDVGADYEDYTDMLNKLNNAHTG-TTPTSETTAEGEGETDSASSASNDDNVFDDFTSYNAHKK 204
                                 :|.| .:|..:....||....|.|...:...:.:.|  :...|.
Human   104 ---------------------SHLGQPSPKQQPLEPGEAALHSDSQDGHQMALLNFF--FPDEKP 145

  Fly   205 KQERKSRSIADVRNEEQNIQGNHTELQEKSSNEATSKESP-----------------------AP 246
            ..|.:||.:...:..:.| :|....::.|...:......|                       .|
Human   146 YSEEESRRVRRNKRSKSN-EGADGPVKNKKKGKKAGPPGPNGPPGPPGPPGPQGPPGIPGIPGIP 209

  Fly   247 LHHRRRMHSRHRHLLVRKGESLL-------------------------SARSEDSRPAAHFHLSS 286
                              |.:::                         .|.:.:::||. .||..
Human   210 ------------------GTTVMGPPGPPGPPGPQGPPGLQGPSGAADKAGTRENQPAV-VHLQG 255

  Fly   287 RRRHQGS-MGYHGDMYIG--NDNER---NSYQGHFQTRDGVLTVTNTGLYYVYAQ--ICYNNSHD 343
                ||| :....|:..|  ||..|   |........|.|.|.|...|.|::|:|  :.|.|..|
Human   256 ----QGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTD 316

  Fly   344 QNGFIVFQGDTPFLQCLNTVPTNMPHKVHTCHTSGLIHLERNERIHLKDIHNDRNAVLREGNNRS 408
            ...:.|...:.|||||..::.|...: .:||:|:|:..|:..::|.:|.:|.|.:  :....:.:
Human   317 FASYEVVVDEKPFLQCTRSIETGKTN-YNTCYTAGVCLLKARQKIAVKMVHADIS--INMSKHTT 378

  Fly   409 YFGIFKV 415
            :||..::
Human   379 FFGAIRL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 42/142 (30%)
EDANP_001390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..127 15/112 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..245 10/117 (9%)
TNF 249..383 CDD:320782 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11711
eggNOG 1 0.900 - - E1_28MSH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6553
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.