DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and TNFSF13B

DIOPT Version :10

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_006564.1 Gene:TNFSF13B / 10673 HGNCID:11929 Length:285 Species:Homo sapiens


Alignment Length:91 Identity:15/91 - (16%)
Similarity:38/91 - (41%) Gaps:19/91 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESENTDLLRNGTSN------AEVDAEFEDDEEEIQMSSQ-EVLEALQRA---------WINEKFA 56
            ::.:...:|.|::.      ::.|...|:|.|.::..:: :.|..|::|         ..|..:.
Human    48 DTTSNSFVRQGSAESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYN 112

  Fly    57 P---DLLPYEDALVEMVMIQLVHMEE 79
            |   |.:|.:...:.......:|::|
Human   113 PSPGDEVPVQGVAITFEPKDFLHIKE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108
TNFSF13BNP_006564.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..138 3/23 (13%)
TNF 146..282 CDD:238108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.