DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1371 and LOC102723728

DIOPT Version :9

Sequence 1:NP_610551.1 Gene:CG1371 / 36053 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster
Sequence 2:XP_006721059.1 Gene:LOC102723728 / 102723728 -ID:- Length:294 Species:Homo sapiens


Alignment Length:304 Identity:104/304 - (34%)
Similarity:165/304 - (54%) Gaps:23/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 MMKEYKFEPNSKMIDIKDGETVSVTLVGKRFAYSIFGTVSSLNGDPFAGVNVQATADNSCPQQPE 945
            ||||::|||:|:||::::|:.:.:|:.|.|.|||.:||||||||:|..||.::|...|.|....|
Human     1 MMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGE 65

  Fly   946 EATSEANGQYRIRGLQPGCSYSVRVVPD-KEIVERSIPAQHTVKVANEDVRDINLVAISPLKIVD 1009
            :..::..|::|:|||.|||.|.|::..: .:.:||::|....::|.|.|:.|:|::....:...|
Human    66 DTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFD 130

  Fly  1010 ITARVTATLNEHYKTLRIVMYRKGNSDSPVFSQRVGTPVNPKARLNPGITVFFPRIPLDGKSYVV 1074
            ::..| .|.:|:..||.:.:|:..|.|:|:  |.|.        |...:...||.:..||::|||
Human   131 LSGNV-ITSSEYLPTLWVKLYKSENLDNPI--QTVS--------LGQSLFFHFPPLLRDGENYVV 184

  Fly  1075 ELQSTLSDKTYTYKLPSTTFVADRGSVFVELEFKPEVRAAEADLNQNSISALVLIALVAIAFFKQ 1139
            .|.|||....|.|.||..:|.|......:.|.|.|..:..|.|:.|.|..||.|..||.:|.:..
Human   185 LLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNH 249

  Fly  1140 DLATSFLSFVWSKLNDVAA-----------DLAQRQKSKTQVRK 1172
            |.....|..:.|:|..|.|           :.|:||..|.:.|:
Human   250 DKLIPLLLQLTSRLQGVGALGQAASDNSGPEDAKRQAKKQKTRR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350
CarboxypepD_reg 319..>370 CDD:290350
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 11/23 (48%)
CarboxypepD_reg 914..>970 CDD:290350 26/55 (47%)
LOC102723728XP_006721059.1 CarboxypepD_reg 37..120 CDD:290350 32/82 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D361344at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105336
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.