DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CDK11B

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_011540792.1 Gene:CDK11B / 984 HGNCID:1729 Length:804 Species:Homo sapiens


Alignment Length:373 Identity:176/373 - (47%)
Similarity:247/373 - (66%) Gaps:21/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLKSND-VDTNPAPDPQAPITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFEKLNRVGEGSYG 65
            |:|...| |..:||..|          :.|....|..:|.  |.| ||.|.||:.|||:.||:||
Human   408 SALTEGDYVPDSPALSP----------IELKQELPKYLPA--LQG-CRSVEEFQCLNRIEEGTYG 459

  Fly    66 IVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGKSLDSIFLV 130
            :||||:|.:::||||||:::|::||:|.||:.||||..:.:..|.|||.:||:|||.::|.|::|
Human   460 VVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIV 524

  Fly   131 MDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVAD 195
            |::.|.||.|:::.|.|||...|||.:.:|:|:.:|:||..:::|||||.||||::..|.:||.|
Human   525 MNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGD 589

  Fly   196 FGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIA 260
            |||||.:.:|.|..||.:|||||||||||||.:.::||||||:.|||.||||..|||.||.|||.
Human   590 FGLAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEID 654

  Fly   261 QLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKF-HMIGQSGRNLLNILFIYNPKT 324
            |::.:...||.|||.||||:::||||:..|.|:.|||||..:| .::...|.:|:|....|.|..
Human   655 QINKVFKDLGTPSEKIWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGR 719

  Fly   325 RATAEECLKSKYFVDPPQACDPGMMPTFP----QHRNNAAPAPAVQPP 368
            |.:||:.||.:||.:.|...||.|.||:|    |.|.....:|  :||
Human   720 RISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSP--RPP 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 159/308 (52%)
S_TKc 53..337 CDD:214567 146/284 (51%)
CDK11BXP_011540792.1 STKc_CDC2L1 441..732 CDD:173741 150/290 (52%)
PLN00009 444..734 CDD:177649 150/289 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392617at33208
OrthoFinder 1 1.000 - - FOG0001516
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.