DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CDK13

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_016868239.1 Gene:CDK13 / 8621 HGNCID:1733 Length:1542 Species:Homo sapiens


Alignment Length:382 Identity:129/382 - (33%)
Similarity:208/382 - (54%) Gaps:63/382 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RCRPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHE 110
            ||  |.:|:.:..:|||:||.||:|||..:.|:|||||||:|.||:|.||:.:|||.||:|..|:
Human   700 RC--VDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQ 762

  Fly   111 NIVRLREVVVGK--SLD------SIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKY 167
            :|:.::|:|..|  :||      :.:||.::.:.||..:|::....|.|:.:|....|:::.|.|
Human   763 SIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDY 827

  Fly   168 LHSRFMIHRDLKVSNLLMTDKGCIKVADFGLARMFS----------------------------- 203
            .|.:..:|||:|.||:|:.::|.||:|||||||::|                             
Human   828 CHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESAWLMLIWEKVIFIWRILLMQMSAGS 892

  Fly   204 --NPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMII 266
              :..:|.|.:::|||||.||||||...:|.|:|:|:.|||||||...||:...|.|:|||::|.
Human   893 FGDSSRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELIS 957

  Fly   267 DLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEEC 331
            .:.|:|..::||....||........:|....|..:|..|..:..:|.:.:...:|..|.|||:.
Human   958 RICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQA 1022

  Fly   332 LKSKYFVDPPQACDPGMMPTFPQHRNNAAPAPAVQPPADIPI-SDLLNVFIKRQRME 387
            |:.::..|                     ..|:..||.|:|: .|...::.|::|.:
Human  1023 LQCEFLRD---------------------VEPSKMPPPDLPLWQDCHELWSKKRRRQ 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 121/345 (35%)
S_TKc 53..337 CDD:214567 117/322 (36%)
CDK13XP_016868239.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.