DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and KIN28

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_010175.1 Gene:KIN28 / 851450 SGDID:S000002266 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:104/296 - (35%)
Similarity:172/296 - (58%) Gaps:3/296 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLR 116
            |:.|..:||||:|.:||......:...:|:|:::..:.||||.:|.:||:..|::..|.|::.|.
Yeast     6 EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELI 70

  Fly   117 EVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVS 181
            ::.:  :.|::.||::|...||..|:.:.|..||.:::|...|..|:.:.:.|..|::|||||.:
Yeast    71 DIFM--AYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPN 133

  Fly   182 NLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGEL 246
            |||.:..|.||||||||||....|.:.:|..:||.||||||||.|.:.:|:|:|:|:.|.|..||
Yeast   134 NLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAEL 198

  Fly   247 LLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQP-YNNLTPKFHMIGQSG 310
            :|..|.|||.:::.|:::....||.|::..||..:.........:...| .:.|..:|....:..
Yeast   199 MLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYA 263

  Fly   311 RNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDP 346
            .:.:..:...||:.|.||.:||:|.||.:.|...||
Yeast   264 LDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 104/296 (35%)
S_TKc 53..337 CDD:214567 98/284 (35%)
KIN28NP_010175.1 STKc_CDK7 7..302 CDD:270833 103/295 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.