DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT1G74330

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_177573.2 Gene:AT1G74330 / 843774 AraportID:AT1G74330 Length:699 Species:Arabidopsis thaliana


Alignment Length:321 Identity:135/321 - (42%)
Similarity:194/321 - (60%) Gaps:17/321 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQ-EKDGLPISGLREIMILKQCHHENIVRLR 116
            ||||.::|:|:|..|:||.:|.:..||||||||.|. |.:.:.... |||:||::.:|.||::|.
plant   121 FEKLEKIGQGTYSNVFRAVETETGRIVALKKVRFDNFEPESVKFMA-REILILRRLNHPNIIKLE 184

  Fly   117 EVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVS 181
            .::..|...:|.||.::.|.||..:|.:....||..::||...|:|..|.:.|||.::|||:|.|
plant   185 GLITSKLSCNIQLVFEYMEHDLTGLLSSPDIKFTTPQIKCYMKQLLSGLDHCHSRGVMHRDIKGS 249

  Fly   182 NLLMTDKGCIKVADFGLARMFSN----PPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCI 242
            |||::::|.:||||||||. |||    ..||:|.::||||||.||||||...:..:||:|:.||:
plant   250 NLLLSNEGILKVADFGLAN-FSNSSGHKKKPLTSRVVTLWYRPPELLLGATDYGASVDLWSVGCV 313

  Fly   243 LGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNN-LTPKFHMI 306
            ..|||||||:|.|.:|:.||..|..|.|:|.|..|.. :.||....|. .||.|:: |......:
plant   314 FAELLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKK-SKLPHAMLFK-PQQTYDSCLRETLKDL 376

  Fly   307 GQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFP-------QHRNNAA 360
            .::..||:..|...:|..|.||...|.|:||...|.||||..:|.:|       :||:.||
plant   377 SETEINLIETLLSIDPHKRGTASSALVSQYFTTKPFACDPSSLPIYPPSKEIDTKHRDEAA 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 130/305 (43%)
S_TKc 53..337 CDD:214567 122/289 (42%)
AT1G74330NP_177573.2 STKc_CDK9_like 121..407 CDD:270832 122/289 (42%)
PTZ00024 127..420 CDD:240233 125/296 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.