DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT1G71530

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_177308.3 Gene:AT1G71530 / 843493 AraportID:AT1G71530 Length:655 Species:Arabidopsis thaliana


Alignment Length:313 Identity:123/313 - (39%)
Similarity:186/313 - (59%) Gaps:12/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RCRPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVR---MDQEKDGLPISGLREIMILKQC 107
            ||  ...||||:::|:|:|..||:|||..:.:|||:||||   ||.|.....   .|||:||::.
plant   142 RC--AESFEKLDKIGQGTYSSVYKARDLETGKIVAMKKVRFVNMDPESVRFM---AREILILRKL 201

  Fly   108 HHENIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRF 172
            .|.|:::|..:|..:...|::||.::.|.|||.:.......|:|.::||...|:.:.|::.|.|.
plant   202 DHPNVMKLEGLVTSRLSGSLYLVFEYMEHDLAGLAATPGIKFSEPQIKCYMQQLFRGLEHCHRRG 266

  Fly   173 MIHRDLKVSNLLMTDKGCIKVADFGLARMF-SNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDM 236
            ::|||:|.||||:.::|.:|:.|||||..: .:....:|.::|||||||||||||...:..|:|:
plant   267 ILHRDIKGSNLLINNEGVLKIGDFGLANFYRGDGDLQLTSRVVTLWYRAPELLLGATEYGPAIDL 331

  Fly   237 WAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNN-LT 300
            |:.||||.||..|||::||.:|:.|:..|..|.|:|||..|.. |.||...:|..| .||.. |.
plant   332 WSAGCILTELFAGKPIMPGRTEVEQMHKIFKLCGSPSEDYWRR-ATLPLATSFKPS-HPYKPVLA 394

  Fly   301 PKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFP 353
            ..|:....|...|:|.|....|:.|.:|...|:|::|...|...:|..:|.:|
plant   395 ETFNHFPSSALMLINKLLAIEPEKRGSAASTLRSEFFTTEPLPANPSNLPRYP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 122/311 (39%)
S_TKc 53..337 CDD:214567 116/288 (40%)
AT1G71530NP_177308.3 STKc_CDK9_like 147..431 CDD:270832 116/288 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.