DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT1G57700

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_176083.2 Gene:AT1G57700 / 842146 AraportID:AT1G57700 Length:692 Species:Arabidopsis thaliana


Alignment Length:373 Identity:128/373 - (34%)
Similarity:195/373 - (52%) Gaps:51/373 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVR---MDQEKDGLPISGLREIMILKQCHH 109
            |....||||..:|:|:|..||||||..:|:||||||||   ||.|.....   .|||:||::.:|
plant   141 RSADSFEKLEMIGQGTYSSVYRARDLETNQIVALKKVRFANMDPESVRFM---AREIIILRRLNH 202

  Fly   110 ENIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMI 174
            .|:::|..:::.|:..|::|:.::.:.|||.:.......|:::::||...|:|..|::.||..::
plant   203 PNVMKLEGLIISKASGSMYLIFEYMDHDLAGLASTPGIKFSQAQIKCYMKQLLLGLEHCHSCGVL 267

  Fly   175 HRDLKVSNLLMTDKGCIKVADFGLARMFSNPPK-PMTPQMVTLWYRAPELLLGCRTHTTAVDMWA 238
            |||:|.||||:.....:|:.||||:..:....| |:|.::||||||.||||||...:...||:|:
plant   268 HRDIKCSNLLLDRNNNLKIGDFGLSNFYRGQRKQPLTSRVVTLWYRPPELLLGSTDYGVTVDLWS 332

  Fly   239 FGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTL--SQQPYNN-LT 300
            .||||.||..|||||||.:|:.|:..|..|.|:|||..|    ....:::.|:  .|.||.. :.
plant   333 TGCILAELFTGKPLLPGRTEVEQMHKIFKLCGSPSEEYW----RRSRLRHATIFKPQHPYKRCVA 393

  Fly   301 PKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHR--------- 356
            ..|..:..|...||.:|....|..|.||...|:|::|...|...:|..:|.:...:         
plant   394 DTFKDLPSSALALLEVLLAVEPDARGTASSALQSEFFTTKPFPSEPSSLPRYQPRKEFDAKLREE 458

  Fly   357 ---------------------NNAAPAPAVQPPADIPISDLLNVFIKR 383
                                 :.|.|||:..       ::||....||
plant   459 EARRRKGSSSKQNEQKRLARESKAVPAPSAN-------AELLASIQKR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 120/311 (39%)
S_TKc 53..337 CDD:214567 115/290 (40%)
AT1G57700NP_176083.2 PKc_like 146..430 CDD:304357 115/290 (40%)
PTZ00024 152..443 CDD:240233 114/297 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.