DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT1G54610

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001117490.1 Gene:AT1G54610 / 841903 AraportID:AT1G54610 Length:572 Species:Arabidopsis thaliana


Alignment Length:358 Identity:135/358 - (37%)
Similarity:200/358 - (55%) Gaps:50/358 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQ-EKDGLPISGLREIMILKQCHHEN 111
            |....|||::::|:|:|..||:|:|..:.:||||||||.|. |.:.:.... |||::|::..|.|
plant   113 RKADTFEKIDKIGQGTYSNVYKAKDMLTGKIVALKKVRFDNLEPESVKFMA-REILVLRRLDHPN 176

  Fly   112 IVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHR 176
            :|:|..:|..:...|::||..:.:.|||.:..:....|:||||||:..|::..|::.|||.::||
plant   177 VVKLEGLVTSRMSCSLYLVFQYMDHDLAGLASSPVVKFSESEVKCLMRQLISGLEHCHSRGVLHR 241

  Fly   177 DLKVSNLLMTDKGCIKVADFGLARMFS-NPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFG 240
            |:|.||||:.|.|.:|:||||||.:|. |..:|||.::|||||||||||||...:...:|:|:.|
plant   242 DIKGSNLLIDDGGVLKIADFGLATIFDPNHKRPMTSRVVTLWYRAPELLLGATDYGVGIDLWSAG 306

  Fly   241 CILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFT-----LSQQPY-NNL 299
            |||.|||.|:|::||.:|:.||..|..|.|:|||..|       ....||     ..::|| .::
plant   307 CILAELLAGRPIMPGRTEVEQLHKIYKLCGSPSEDYW-------KKGKFTHGAIYKPREPYKRSI 364

  Fly   300 TPKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFP----------- 353
            ...|.....|...|::.|....|:.|.||...|||::|...|.||:|..:|.:|           
plant   365 RETFKDFPPSSLPLIDALLSIEPEDRQTASAALKSEFFTSEPYACEPADLPKYPPSKEIDAKRRD 429

  Fly   354 --------------------QHR---NNAAPAP 363
                                :||   |.|.|||
plant   430 EETRRQRAASKAQGDGARKNRHRDRSNRALPAP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 127/312 (41%)
S_TKc 53..337 CDD:214567 120/291 (41%)
AT1G54610NP_001117490.1 STKc_CDK9_like 118..402 CDD:270832 120/291 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.