DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT1G53050

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001321170.1 Gene:AT1G53050 / 841739 AraportID:AT1G53050 Length:694 Species:Arabidopsis thaliana


Alignment Length:309 Identity:135/309 - (43%)
Similarity:186/309 - (60%) Gaps:6/309 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQ-EKDGLPISGLREIMILKQCHHEN 111
            |....||||:::|:|:|..||||||....:||||||||.|. |.:.:.... |||.||::..|.|
plant   129 RRADSFEKLDKIGQGTYSNVYRARDLDQKKIVALKKVRFDNLEPESVRFMA-REIQILRRLDHPN 192

  Fly   112 IVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHR 176
            |::|..:|..:...|::||.::.|.|||.:..:.:..|:||:|||...|:|..|.:.|||.::||
plant   193 IIKLEGLVTSRMSCSLYLVFEYMEHDLAGLASHPAIKFSESQVKCYLQQLLHGLDHCHSRGVLHR 257

  Fly   177 DLKVSNLLMTDKGCIKVADFGLARMFS-NPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFG 240
            |:|.||||:.:.|.:|:||||||..|. ...:|:|.::||||||.||||||...:..|||:|:.|
plant   258 DIKGSNLLIDNSGVLKIADFGLASFFDPRQTQPLTSRVVTLWYRPPELLLGATRYGAAVDLWSAG 322

  Fly   241 CILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPK-FH 304
            |||.||..|||::||.:|:.||..|..|.|:|:|..|.. :.||....|. ..|||..|..: |.
plant   323 CILAELYAGKPIMPGRTEVEQLHKIFKLCGSPTEDYWVK-SRLPHATIFK-PTQPYKRLVGETFK 385

  Fly   305 MIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFP 353
            ...|....||..|...||..|.||...|||::|...|..|||..:|.:|
plant   386 EFPQPALALLETLLSVNPDDRGTATAALKSEFFSTRPLPCDPSSLPKYP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 134/307 (44%)
S_TKc 53..337 CDD:214567 127/286 (44%)
AT1G53050NP_001321170.1 STKc_CDK9_like 134..418 CDD:270832 127/286 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.