DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT1G33770

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_174637.1 Gene:AT1G33770 / 840268 AraportID:AT1G33770 Length:614 Species:Arabidopsis thaliana


Alignment Length:311 Identity:123/311 - (39%)
Similarity:184/311 - (59%) Gaps:10/311 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVR---MDQEKDGLPISGLREIMILKQCHH 109
            |....||||:::|:|:|.|||:|||..:.:|||:||||   ||.|.....   .|||.||::..|
plant   136 RRADSFEKLDKIGQGTYSIVYKARDLETGKIVAMKKVRFANMDPESVRFM---AREINILRKLDH 197

  Fly   110 ENIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMI 174
            .|:::|:.:|..|...|:.||.::.|.||:.:.......|||.::||...|:|..|::.|||.::
plant   198 PNVMKLQCLVTSKLSGSLHLVFEYMEHDLSGLALRPGVKFTEPQIKCFMKQLLCGLEHCHSRGIL 262

  Fly   175 HRDLKVSNLLMTDKGCIKVADFGLARMFS-NPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWA 238
            |||:|.||||:.:.|.:|:.|||||..:. :..:|:|.::|||||||||||||...:..|:|:|:
plant   263 HRDIKGSNLLVNNDGVLKIGDFGLASFYKPDQDQPLTSRVVTLWYRAPELLLGSTEYGPAIDLWS 327

  Fly   239 FGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNN-LTPK 302
            .||||.||.:.||::||.:|:.|:..|..|.|:|||..| .....|...::. .|.||.. |...
plant   328 VGCILAELFVCKPIMPGRTEVEQMHKIFKLCGSPSEEFW-NTTKFPQATSYK-PQHPYKRVLLET 390

  Fly   303 FHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFP 353
            |..:..|..:||:.|....|:.|.:|...|.|::|...|..|....:|.:|
plant   391 FKNLSSSSLDLLDKLLSVEPEKRCSASSTLLSEFFTTEPLPCHISSLPKYP 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 122/309 (39%)
S_TKc 53..337 CDD:214567 117/288 (41%)
AT1G33770NP_174637.1 STKc_CDK9_like 141..425 CDD:270832 117/288 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.