DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT5G50860

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_199899.1 Gene:AT5G50860 / 835158 AraportID:AT5G50860 Length:580 Species:Arabidopsis thaliana


Alignment Length:347 Identity:135/347 - (38%)
Similarity:197/347 - (56%) Gaps:36/347 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MSLNTGTPMPIPEQNLFGRC---------RPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKK 83
            |||.|....|   ..|...|         |..:.:|||.::|:|:|..||:|:|..|.:||||||
plant    83 MSLRTPEGWP---PWLIAACGDSIKDLTPRRATTYEKLEKIGQGTYSNVYKAKDLLSGKIVALKK 144

  Fly    84 VRMDQ-EKDGLPISGLREIMILKQCHHENIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQ 147
            ||.|. |.:.:.... |||::|::.:|.|:::|:.:|..:...|::||.::.|.||:.:......
plant   145 VRFDNLEAESVKFMA-REILVLRRLNHPNVIKLQGLVTSRVSCSLYLVFEYMEHDLSGLAATQGL 208

  Fly   148 PFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVADFGLARMFSNPPK-PMTP 211
            .|...:|||...|:|..|::.|||.::|||:|.||||:.:.|.:|:||||||..:....| .||.
plant   209 KFDLPQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDNDGILKIADFGLATFYDPKQKQTMTS 273

  Fly   212 QMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESI 276
            ::||||||.||||||..::.|.||:|:.|||:.|||.|||::||.:|:.||..|..|.|:||:|.
plant   274 RVVTLWYRPPELLLGATSYGTGVDLWSAGCIMAELLAGKPVMPGRTEVEQLHKIFKLCGSPSDSY 338

  Fly   277 WPGFADLPAVQNFTL--SQQPY--------NNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEEC 331
            |..:. ||   |.||  .|.||        |..||       |..:|:..|...:|..|.|:...
plant   339 WKKYR-LP---NATLFKPQHPYKRCVAEAFNGFTP-------SSVHLVETLLTIDPADRGTSTSA 392

  Fly   332 LKSKYFVDPPQACDPGMMPTFP 353
            |.|::|...|..|||..:|.:|
plant   393 LNSEFFTTEPLPCDPSSLPKYP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 128/328 (39%)
S_TKc 53..337 CDD:214567 120/295 (41%)
AT5G50860NP_199899.1 STKc_CDK9_like 114..398 CDD:270832 120/295 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.