DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT5G44290

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001032009.1 Gene:AT5G44290 / 834452 AraportID:AT5G44290 Length:644 Species:Arabidopsis thaliana


Alignment Length:354 Identity:135/354 - (38%)
Similarity:195/354 - (55%) Gaps:47/354 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGL-------REIMILK 105
            |..|.||||.::|:|:|..||:|||..:|:|||||:||.|       :|.|       |||::::
plant   132 RRASTFEKLEKIGQGTYSSVYKARDLTNNKIVALKRVRFD-------LSDLESVKFMAREIIVMR 189

  Fly   106 QCHHENIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHS 170
            :..|.|:::|..::......|::||.::.:.||..:.......|:|.:|||...|:|..|.:.||
plant   190 RLDHPNVLKLEGLITASVSSSLYLVFEYMDHDLVGLASIPGIKFSEPQVKCYMQQLLSGLHHCHS 254

  Fly   171 RFMIHRDLKVSNLLMTDKGCIKVADFGLARMFSNPPK--PMTPQMVTLWYRAPELLLGCRTHTTA 233
            |.::|||:|.||||:...|.:|:||||||..| :|..  |:|.::||||||.||||||...:...
plant   255 RGVLHRDIKGSNLLIDSNGVLKIADFGLATFF-DPQNCVPLTSRVVTLWYRPPELLLGACHYGVG 318

  Fly   234 VDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIW------PGFADLPAVQNFTLS 292
            ||:|:.|||||||..|||:|.|.:|:.||..|..|.|:|:|..|      |..|..||:      
plant   319 VDLWSTGCILGELYSGKPILAGKTEVEQLHKIFKLCGSPTEDYWRKLKLPPSAAFRPAL------ 377

  Fly   293 QQPY-NNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHR 356
              || ..:...|..:..:..:||..|...:|..|.:|...|:|:||...|.||||..:|.:|   
plant   378 --PYGRRVAEMFKDLPTNVLSLLEALLSIDPDRRGSAARALESEYFRTEPFACDPSSLPKYP--- 437

  Fly   357 NNAAPAPAVQPPADIPISDLLNVFIKRQR 385
                |:..:    |..|.|    ..||||
plant   438 ----PSKEI----DAKIRD----DAKRQR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 126/320 (39%)
S_TKc 53..337 CDD:214567 116/299 (39%)
AT5G44290NP_001032009.1 STKc_CDK9_like 137..421 CDD:270832 116/299 (39%)
S_TKc 137..421 CDD:214567 116/299 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.