DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdc2cAt

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_198758.2 Gene:cdc2cAt / 833938 AraportID:AT5G39420 Length:644 Species:Arabidopsis thaliana


Alignment Length:307 Identity:123/307 - (40%)
Similarity:190/307 - (61%) Gaps:6/307 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQ-EKDGLPISGLREIMILKQCHHENIVRLR 116
            |:||.::|:|:|..|:|||:..:.::||||||:.|. :.:.:.... |||:||::.:|.||::|.
plant   105 FQKLEKIGQGTYSSVFRAREVETGKMVALKKVKFDNLQPESIRFMA-REILILRKLNHPNIMKLE 168

  Fly   117 EVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVS 181
            .:|..::..||:||.::.|.|||.:..|....|||.::||...|:|..|::.|.|.:||||:|.|
plant   169 GIVTSRASSSIYLVFEYMEHDLAGLSSNPDIRFTEPQIKCYMKQLLWGLEHCHMRGVIHRDIKAS 233

  Fly   182 NLLMTDKGCIKVADFGLARMFSNPPK-PMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGE 245
            |:|:.:||.:|:.|||||.:.:...| .:|.::|||||||||||:|..::..:||:|:.||:..|
plant   234 NILVNNKGVLKLGDFGLANVVTPSNKNQLTSRVVTLWYRAPELLMGSTSYGVSVDLWSVGCVFAE 298

  Fly   246 LLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYN-NLTPKFHMIGQS 309
            :|:|||:|.|.:||.||..|..|.|:|.:|.|.. ..||...:|. .|..|. .|..:...:..:
plant   299 ILMGKPILKGRTEIEQLHKIYKLCGSPQDSFWKR-TKLPHATSFK-PQHTYEATLRERCKDLSAT 361

  Fly   310 GRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHR 356
            |..||..|....|..|.||...|.|:||:..|.||||..:|.:|.::
plant   362 GVYLLETLLSMEPDKRGTASSALNSEYFLTRPYACDPSSLPKYPPNK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 122/302 (40%)
S_TKc 53..337 CDD:214567 114/286 (40%)
cdc2cAtNP_198758.2 STKc_CDK9_like 105..389 CDD:270832 114/286 (40%)
S_TKc 105..389 CDD:214567 114/286 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.