DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CDKC;1

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_196589.1 Gene:CDKC;1 / 830891 AraportID:AT5G10270 Length:505 Species:Arabidopsis thaliana


Alignment Length:368 Identity:143/368 - (38%)
Similarity:211/368 - (57%) Gaps:35/368 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNTGTPMPIPEQNLFGRCRPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLP 94
            ||...|.||     :| .|.|..||||.::|||:||.||.|::.::.|||||||:|||.|::|.|
plant     9 LNLEEPPPI-----WG-SRSVDCFEKLEQIGEGTYGQVYMAKEIKTGEIVALKKIRMDNEREGFP 67

  Fly    95 ISGLREIMILKQCHHENIVRLREVVVGKSLD--------------SIFLVMDFCEQDLASVLDNM 145
            |:.:|||.|||:.||||:::|:|:|.....|              .|::|.::.:.||..:.|..
plant    68 ITAIREIKILKKLHHENVIQLKEIVTSPGRDRDDQGKPDNNKYKGGIYMVFEYMDHDLTGLADRP 132

  Fly   146 SQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVADFGLARMFSNP-PKPM 209
            ...||..::||...|:|..|.|.|...::|||:|.||||:.::|.:|:|||||||.:|:. ...:
plant   133 GLRFTVPQIKCYMKQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYSHDHTGNL 197

  Fly   210 TPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSE 274
            |.:::|||||.||||||...:..|:|||:.|||..|||..||:|||.:|..||:.|.:|.|:|.|
plant   198 TNRVITLWYRPPELLLGATKYGPAIDMWSVGCIFAELLHAKPILPGKNEQEQLNKIFELCGSPDE 262

  Fly   275 SIWPGFADLPAVQNFTLSQQPYNNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVD 339
            .:|||.:.:|...||..::.....:...|....:....||..:.:.:|..|.:|::.|.::||..
plant   263 KLWPGVSKMPWFNNFKPARPLKRRVREFFRHFDRHALELLEKMLVLDPAQRISAKDALDAEYFWT 327

  Fly   340 PPQACDPGMMPTF------------PQHRNN--AAPAPAVQPP 368
            .|..|||..:||:            .|.|.|  ||....:|.|
plant   328 DPLPCDPKSLPTYESSHEFQTKKKRQQQRQNEEAAKRQKLQHP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 131/334 (39%)
S_TKc 53..337 CDD:214567 120/298 (40%)
CDKC;1NP_196589.1 STKc_CDK9_like 26..325 CDD:270832 120/298 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.