DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT3G01085

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001325617.1 Gene:AT3G01085 / 821283 AraportID:AT3G01085 Length:631 Species:Arabidopsis thaliana


Alignment Length:373 Identity:128/373 - (34%)
Similarity:206/373 - (55%) Gaps:28/373 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDTNPAP----DPQAPITR-KGFLMSLNTGTPMPIPEQNLFGRCRP------------------V 50
            |:::|..    |..||.:| .|  :||.:|.|....|........|                  .
plant    50 VNSSPKKHRNNDDDAPKSRTTG--VSLRSGLPHSNVEAEQVAAGWPSWLSSAAPEAVHGWVPLRA 112

  Fly    51 SEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQ-EKDGLPISGLREIMILKQCHHENIVR 114
            .:|||..::|:|:|..|:||.:..:..::||||:|:.. |.:.:.... ||||||::..|.||::
plant   113 EDFEKREKIGQGTYSNVFRACEVSTGRVMALKKIRIQNFETENIRFIA-REIMILRRLDHPNIMK 176

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLK 179
            |..::..::.:|::.|.|:.|.||..:..:....|||:::||...|:|..:::.|.|.::|||:|
plant   177 LEGIIASRNSNSMYFVFDYMEHDLEGLCSSPDIKFTEAQIKCYMKQLLWGVEHCHLRGIMHRDIK 241

  Fly   180 VSNLLMTDKGCIKVADFGLARMFSNPPK-PMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCIL 243
            .:|:|:.:||.:|:||||||.:.:...| .:|.::|||||||||||:|..:::.:||:|:.||:.
plant   242 AANILVNNKGVLKLADFGLANIVTPRNKNQLTSRVVTLWYRAPELLMGSTSYSVSVDLWSVGCVF 306

  Fly   244 GELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKFHMIGQ 308
            .|:|.|:|||.|.:||.||..|..|.|:|.|..|......|..:.|....|....|..:|....:
plant   307 AEILTGRPLLKGRTEIEQLHKIYKLSGSPDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFDEFPK 371

  Fly   309 SGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHR 356
            :..|||..|...:|:.|.||...|.|:||...|.||||..:|.:|.::
plant   372 TAINLLENLLSIDPEKRGTASSALMSEYFNTQPYACDPSTLPKYPPNK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 115/327 (35%)
S_TKc 53..337 CDD:214567 106/285 (37%)
AT3G01085NP_001325617.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.