DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT3G05050

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001326094.1 Gene:AT3G05050 / 819667 AraportID:AT3G05050 Length:593 Species:Arabidopsis thaliana


Alignment Length:356 Identity:132/356 - (37%)
Similarity:201/356 - (56%) Gaps:26/356 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PDPQAPITRKGFL-MSLNTGTPMPIPE---QNLFGRC-RPVSEFEKLNRVGEGSYGIVYRARDTR 74
            |||:.....|..| ..:..|.|..:.|   :.|.|.. |....|||::::|.|:|..||:|:|:.
plant    95 PDPRRSNPPKNLLGEQVAAGWPSWLSEVCGEALSGWLPRKADSFEKIDKIGSGTYSNVYKAKDSL 159

  Fly    75 SNEIVALKKVRMD-QEKDGLPISGLREIMILKQCHHENIVRLREVVVGKSLDSIFLVMDFCEQDL 138
            :..||||||||.| .|::.|.... |||:||::..|.|:::|..:|..:...|::||..:.:.||
plant   160 TGNIVALKKVRCDVNERESLKFMA-REILILRRLDHPNVIKLEGLVTSRMSSSLYLVFRYMDHDL 223

  Fly   139 ASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVADFGLARMF- 202
            |.:..:....|||.:|||...|:|..|::.|:|.::|||:|.||||:.|.|.:::.|||||..| 
plant   224 AGLAASPEIKFTEQQVKCYMKQLLSGLEHCHNRGVLHRDIKGSNLLIDDGGVLRIGDFGLATFFD 288

  Fly   203 SNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIID 267
            ::..:.||.::||||||:||||.|...::..||:|:.||||.|||.|:.::||.:|:.||..|..
plant   289 ASKRQEMTNRVVTLWYRSPELLHGVVEYSVGVDLWSAGCILAELLAGRAIMPGRNEVEQLHRIYK 353

  Fly   268 LLGAPSESIWPGFADLPAVQNFT----LSQ------QPYNNLTPKFHMIGQSGRNLLNILFIYNP 322
            |.|:|||..|.... ||:.....    |.|      :.|.:.:|:       ..:||:.|...:|
plant   354 LCGSPSEEYWKKIR-LPSTHKHAHHKPLPQYKRRIREVYKDFSPE-------ALSLLDTLLALDP 410

  Fly   323 KTRATAEECLKSKYFVDPPQACDPGMMPTFP 353
            ..|.||.:.|.|.:|...|.||.|..:|.:|
plant   411 AERQTATDVLMSDFFTTEPLACQPSDLPKYP 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 122/320 (38%)
S_TKc 53..337 CDD:214567 114/295 (39%)
AT3G05050NP_001326094.1 PKc_like 138..425 CDD:419665 114/295 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.