DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CDK11A

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001300825.1 Gene:CDK11A / 728642 HGNCID:1730 Length:783 Species:Homo sapiens


Alignment Length:374 Identity:177/374 - (47%)
Similarity:246/374 - (65%) Gaps:23/374 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLKSNDVDTNPAPDPQA--PITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFEKLNRVGEGSY 64
            |:|...|.    .||..|  ||..|..|       |..:|.  |.| ||.|.||:.|||:.||:|
Human   387 SALTEGDY----VPDSPALLPIELKQEL-------PKYLPA--LQG-CRSVEEFQCLNRIEEGTY 437

  Fly    65 GIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGKSLDSIFL 129
            |:||||:|.:::||||||:::|::||:|.||:.||||..:.:..|.|||.:||:|||.::|.|::
Human   438 GVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYI 502

  Fly   130 VMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVA 194
            ||::.|.||.|:::.|.|||...|||.:.:|:|:.:|:||..:::|||||.||||::..|.:||.
Human   503 VMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVG 567

  Fly   195 DFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEI 259
            ||||||.:.:|.|..||.:||.||||||||||.:.::||||||:.|||.||||..|||.||||||
Human   568 DFGLAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNSEI 632

  Fly   260 AQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKF-HMIGQSGRNLLNILFIYNPK 323
            .|::.:...||.|||.||||:::||.|:..|.|:.|||||..:| .::...|.:|:|....|.|.
Human   633 DQINKVFKELGTPSEKIWPGYSELPVVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPG 697

  Fly   324 TRATAEECLKSKYFVDPPQACDPGMMPTFP----QHRNNAAPAPAVQPP 368
            .|.:||:.||.:||.:.|...||.|.||:|    |.|.....:|  :||
Human   698 RRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSP--RPP 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 158/308 (51%)
S_TKc 53..337 CDD:214567 145/284 (51%)
CDK11ANP_001300825.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..396 3/12 (25%)
STKc_CDC2L1 420..711 CDD:173741 149/290 (51%)
PLN00009 423..713 CDD:177649 149/289 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 721..783 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392617at33208
OrthoFinder 1 1.000 - - FOG0001516
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.