DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CDK12

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_057591.2 Gene:CDK12 / 51755 HGNCID:24224 Length:1490 Species:Homo sapiens


Alignment Length:423 Identity:142/423 - (33%)
Similarity:224/423 - (52%) Gaps:58/423 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKSNDVDTNPAPDPQA------PITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFEKLNRVGEG 62
            |...|:....:|:|:|      |..::..:.....|.... .|.:...||  |.:|:.:..:|||
Human   675 LPGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQ-TESDWGKRC--VDKFDIIGIIGEG 736

  Fly    63 SYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGK--SLD 125
            :||.||:|:|..:.|:|||||||:|.||:|.||:.:|||.||:|..|.::|.::|:|..|  :||
Human   737 TYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALD 801

  Fly   126 ------SIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLL 184
                  :.:||.::.:.||..:|::....|:|..:|....|:::.|:|.|.:..:|||:|.||:|
Human   802 FKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNIL 866

  Fly   185 MTDKGCIKVADFGLARMF-SNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLL 248
            :.:.|.||:|||||||:: |...:|.|.:::|||||.||||||...:|.|:|:|:.|||||||..
Human   867 LNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFT 931

  Fly   249 GKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKFHMIGQSGRNL 313
            .||:...|.|:|||::|..|.|:|..::||....||........:|....|..:|..|..:..:|
Human   932 KKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDL 996

  Fly   314 LNILFIYNPKTRATAEECLKSKYFVD-------PP-----QAC------------DPGMMPTFP- 353
            |:.:...:|..|.|||:.|:|.:..|       ||     |.|            ..|::...| 
Human   997 LDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPP 1061

  Fly   354 ---------------QHRNNAAPAPAVQPPADI 371
                           :...|::|||....|..:
Human  1062 PSKTSRKETTSGTSTEPVKNSSPAPPQPAPGKV 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 128/340 (38%)
S_TKc 53..337 CDD:214567 119/292 (41%)
CDK12NP_057591.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..703 6/27 (22%)
STKc_CDK12 719..1020 CDD:270847 122/302 (40%)
S_TKc 727..1020 CDD:214567 119/292 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1047..1098 7/48 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1161..1189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1220..1348
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1441..1460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1466..1490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.