DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and Cdk12

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster


Alignment Length:319 Identity:126/319 - (39%)
Similarity:191/319 - (59%) Gaps:17/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RCRPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHE 110
            ||  |..||.:.::|||:||.||:|||..:|::|||||||::.||:|.||:.:|||.||:|.:|.
  Fly   799 RC--VDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHR 861

  Fly   111 NIVRLREVVVG--------KSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKY 167
            |||.|.|:|..        |...|.:||.::.:.||..:|::....|.|.....|..|:|..|.|
  Fly   862 NIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNY 926

  Fly   168 LHSRFMIHRDLKVSNLLMTDKGCIKVADFGLARMFS--NPPKPMTPQMVTLWYRAPELLLGCRTH 230
            .|.:..:|||:|.||:||.::|.:|:|||||||:::  :..:|.|.:::|||||.||||||...:
  Fly   927 CHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERY 991

  Fly   231 TTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQP 295
            ..::|:|:.|||||||.:.:||...|:|:|||:.|..:.|:|..::||....||........:..
  Fly   992 GPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTH 1056

  Fly   296 YNNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQ 354
            ...|...|..:.....:||:.:...:|..|.|||:.|:|.:.    :..:|..||| ||
  Fly  1057 RRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWL----RKINPDEMPT-PQ 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 124/316 (39%)
S_TKc 53..337 CDD:214567 117/293 (40%)
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 120/300 (40%)
S_TKc 804..1098 CDD:214567 117/293 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.