DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdk1

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_988908.1 Gene:cdk1 / 394503 XenbaseID:XB-GENE-482750 Length:302 Species:Xenopus tropicalis


Alignment Length:310 Identity:123/310 - (39%)
Similarity:185/310 - (59%) Gaps:10/310 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVR 114
            :.|:.|:.::|||:||:||:.|...:.::||:||:|::.|::|:|.:.:|||.:||:..|.|||.
 Frog     1 MDEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSTAIREISLLKELQHPNIVC 65

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNM--SQPFTESEVKCITLQVLKALKYLHSRFMIHRD 177
            |.:|::..|  .::|:.:|...||...||::  .|......||....|:|:.:.:.|||.::|||
 Frog    66 LLDVLMQDS--RLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCHSRRVLHRD 128

  Fly   178 LKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCI 242
            ||..|||:..||.||:|||||||.|..|.:..|.::|||||||||:|||...::|.||:|:.|.|
 Frog   129 LKPQNLLIDSKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSIGTI 193

  Fly   243 LGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKFHMIG 307
            ..|:...|||..|:|||.||..|...||.|:..:||....|...:| |..:....||:.....|.
 Frog   194 FAEIATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKN-TFPKWKGGNLSANVKNID 257

  Fly   308 QSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHRN 357
            :.|.:||:.:.||:|..|.:|.:.|...||.|    .|...:|. .|.||
 Frog   258 KDGLDLLSKMLIYDPAKRISARKALLHPYFDD----LDKSSLPA-NQIRN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 120/304 (39%)
S_TKc 53..337 CDD:214567 114/285 (40%)
cdk1NP_988908.1 STKc_CDK1_euk 3..287 CDD:270845 115/286 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.