DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and Cdk5

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster


Alignment Length:300 Identity:120/300 - (40%)
Similarity:185/300 - (61%) Gaps:22/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVR 114
            :.:::|:.::|||:||.|::.|:..:.||||||:||:|::.:|:|.|.||||.:||:..|:||||
  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVR 65

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLK 179
            |.:|:  .|...:.||.:.|:|||....|:::.....:..:...||:|:.|.:.||..::|||||
  Fly    66 LIDVL--HSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128

  Fly   180 VSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILG 244
            ..|||:...|.:|:|||||||.|..|.|..:.::||||||.|::|.|.:.:||::|||:.||||.
  Fly   129 PQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILA 193

  Fly   245 ELL-LGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADL---------PAVQNFTLSQQPYNNL 299
            ||. .|:||.||:..:.||..|..:||.|:|..|||.:.|         ||:.:       ::.|
  Fly   194 ELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITS-------WSQL 251

  Fly   300 TPKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVD 339
            .|:   :...||:||..|.|..|..|.:||..::..||.|
  Fly   252 VPR---LNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 119/299 (40%)
S_TKc 53..337 CDD:214567 117/293 (40%)
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 119/298 (40%)
STKc_CDK5 3..286 CDD:143344 117/294 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.