DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and Cdk20

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001020923.2 Gene:Cdk20 / 364666 RGDID:1305219 Length:346 Species:Rattus norvegicus


Alignment Length:335 Identity:124/335 - (37%)
Similarity:184/335 - (54%) Gaps:18/335 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCH-HENIVRLREVV 119
            |.|:|||::|||::|:...:.||||||||.:.:.:||:|...||||..|::.. .:.:|:|:.|.
  Rat     7 LGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIEDSQYVVQLKAVF 71

  Fly   120 VGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLL 184
            ...:  ...|..:|...|||.|:.:..:|...::||.....:||.:.:.|:..::|||||.:|||
  Rat    72 PHGA--GFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLL 134

  Fly   185 MTDKGCIKVADFGLARMFS-NPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLL 248
            ::..|.:|:|||||||:|| :..:..|.|:.|.||||||||.|.|.:...||:||.|||:||||.
  Rat   135 ISASGQLKIADFGLARVFSPDGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGELLN 199

  Fly   249 GKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQ---PYNNLTPKFHMIGQSG 310
            |.||.||.::|.||..::.:||.||..:||...:||.....:..:|   |...:.|.   .....
  Rat   200 GSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPD---ASHQA 261

  Fly   311 RNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHRNNAAPAPAVQPP------A 369
            .:||....:|.|:.|..|.:.|..:||...|....|..:| .||......|.....||      .
  Rat   262 LDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELP-IPQRPGGPTPKAHPGPPHVHDFHV 325

  Fly   370 DIPISD-LLN 378
            |.|:.: |||
  Rat   326 DRPLEESLLN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 114/301 (38%)
S_TKc 53..337 CDD:214567 109/285 (38%)
Cdk20NP_001020923.2 STKc_CCRK 3..289 CDD:270826 110/286 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.