DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and ppk23

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_595739.1 Gene:ppk23 / 2540799 PomBaseID:SPBC18H10.15 Length:398 Species:Schizosaccharomyces pombe


Alignment Length:308 Identity:139/308 - (45%)
Similarity:189/308 - (61%) Gaps:1/308 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CRPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHEN 111
            |..:.::|.|.::.|||||||||..|..:|.:|||||::.|....|.||:.||||..|....|:|
pombe    68 CNSIDDYEILEKIEEGSYGIVYRGLDKSTNTLVALKKIKFDPNGIGFPITSLREIESLSSIRHDN 132

  Fly   112 IVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHR 176
            ||.|.:|||||.|..::|||:|.|.||.::||||.:.|.:||||.:.||:|.|..::|..:.:||
pombe   133 IVELEKVVVGKDLKDVYLVMEFMEHDLKTLLDNMPEDFLQSEVKTLMLQLLAATAFMHHHWYLHR 197

  Fly   177 DLKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGC 241
            |||.|||||.:.|.||:|||||||..|.|...:|..:|||||||||||||..::...:|||:.||
pombe   198 DLKPSNLLMNNTGEIKLADFGLARPVSEPKSSLTRLVVTLWYRAPELLLGAPSYGKEIDMWSIGC 262

  Fly   242 ILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQP-YNNLTPKFHM 305
            |..|::...||..|.||:.||..|.:|||.|:...||.:..||..........| ::.:......
pombe   263 IFAEMITRTPLFSGKSELDQLYKIFNLLGYPTREEWPQYFLLPYANKIKHPTVPTHSKIRTSIPN 327

  Fly   306 IGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFP 353
            :..:..:|||.|...||..|.:|:|.|:..||.:.|:..||...||||
pombe   328 LTGNAYDLLNRLLSLNPAKRISAKEALEHPYFYESPRPKDPKFFPTFP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 137/306 (45%)
S_TKc 53..337 CDD:214567 129/284 (45%)
ppk23NP_595739.1 STKc_CDC2L1 68..359 CDD:173741 130/290 (45%)
PLN00009 71..361 CDD:177649 131/289 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 265 1.000 Domainoid score I354
eggNOG 1 0.900 - - E1_KOG0663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 270 1.000 Inparanoid score I709
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001516
OrthoInspector 1 1.000 - - otm47016
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R970
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.