DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdc2

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001342995.1 Gene:cdc2 / 2539869 PomBaseID:SPBC11B10.09 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:307 Identity:117/307 - (38%)
Similarity:186/307 - (60%) Gaps:29/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHE---- 110
            :..::|:.::|||:||:||:||...|..|||:||:|::.|.:|:|.:.:|||.:||:.:.|    
pombe     1 MENYQKVEKIGEGTYGVVYKARHKLSGRIVAMKKIRLEDESEGVPSTAIREISLLKEVNDENNRS 65

  Fly   111 NIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTES----EVKCITLQVLKALKYLHSR 171
            |.|||.:::..:|  .::||.:|.:.||...:|.:|:....|    .|:..|.|::..:.:.|||
pombe    66 NCVRLLDILHAES--KLYLVFEFLDMDLKKYMDRISETGATSLDPRLVQKFTYQLVNGVNFCHSR 128

  Fly   172 FMIHRDLKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDM 236
            .:||||||..|||:..:|.:|:|||||||.|..|.:..|.::|||||||||:|||.|.::|.||:
pombe   129 RIIHRDLKPQNLLIDKEGNLKLADFGLARSFGVPLRNYTHEIVTLWYRAPEVLLGSRHYSTGVDI 193

  Fly   237 WAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTP 301
            |:.|||..|::...||.||:|||.::..|..:||.|:|.:|||...|          |.|.:..|
pombe   194 WSVGCIFAEMIRRSPLFPGDSEIDEIFKIFQVLGTPNEEVWPGVTLL----------QDYKSTFP 248

  Fly   302 KF-----HMIGQSGR----NLLNILFIYNPKTRATAEECLKSKYFVD 339
            ::     |.:..:|.    .||:.:.:|:|..|.:|:..|:..|..|
pombe   249 RWKRMDLHKVVPNGEEDAIELLSAMLVYDPAHRISAKRALQQNYLRD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 117/307 (38%)
S_TKc 53..337 CDD:214567 115/300 (38%)
cdc2NP_001342995.1 STKc_CDK1_CdkB_like 4..293 CDD:270829 115/300 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.