DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and Cdk11b

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_665709.2 Gene:Cdk11b / 252879 RGDID:628604 Length:784 Species:Rattus norvegicus


Alignment Length:365 Identity:173/365 - (47%)
Similarity:240/365 - (65%) Gaps:20/365 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDTNPAPDPQAPITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFEKLNRVGEGSYGIVYRARDT 73
            |..:||..|          :.|....|..:|.  |.| ||.|.||:.|||:.||:||:||||:|.
  Rat   396 VPDSPALSP----------IELKQELPKYLPA--LQG-CRSVEEFQCLNRIEEGTYGVVYRAKDK 447

  Fly    74 RSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGKSLDSIFLVMDFCEQDL 138
            :::||||||:::|::||:|.||:.||||..:.:..|.|||.:||:|||.::|.|::||::.|.||
  Rat   448 KTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDL 512

  Fly   139 ASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVADFGLARMFS 203
            .|:::.|.|||...|||.:.:|:|..:|:||..:::|||||.||||::..|.:||.||||||.:.
  Rat   513 KSLMETMKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYG 577

  Fly   204 NPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDL 268
            :|.|..||.:|||||||||||||.:.::||||||:.|||.||||..|||.||.|||.|::.:...
  Rat   578 SPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKD 642

  Fly   269 LGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKF-HMIGQSGRNLLNILFIYNPKTRATAEECL 332
            ||.|||.||||:.|||||:..|.|:.|||||..:| .::...|.:|:|....|.|..|.:||:.|
  Rat   643 LGTPSEKIWPGYNDLPAVKKMTFSEYPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRVSAEDGL 707

  Fly   333 KSKYFVDPPQACDPGMMPTFP----QHRNNAAPAPAVQPP 368
            |.:||.:.|...|..|.||:|    |.|.....:|  :||
  Rat   708 KHEYFRETPLPIDSSMFPTWPAKSEQQRVKRGTSP--RPP 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 159/308 (52%)
S_TKc 53..337 CDD:214567 147/284 (52%)
Cdk11bNP_665709.2 STKc_CDC2L1 421..712 CDD:173741 151/290 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392617at33208
OrthoFinder 1 1.000 - - FOG0001516
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.