DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CDK20

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_016870050.1 Gene:CDK20 / 23552 HGNCID:21420 Length:351 Species:Homo sapiens


Alignment Length:340 Identity:123/340 - (36%)
Similarity:185/340 - (54%) Gaps:23/340 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCH-HENIVRLREVV 119
            |.|:|||::|||::|:...:.||||||||.:.:.:||.|...||||..|::.. ::.:|:|:.|.
Human     7 LGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVF 71

  Fly   120 VGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLL 184
            ....  ...|..:|...|||.|:.:..:|..:::||.....:||.:.:.|:..::|||||.:|||
Human    72 PHGG--GFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLL 134

  Fly   185 MTDKGCIKVADFGLARMFS-NPPKPMTPQMVT-----LWYRAPELLLGCRTHTTAVDMWAFGCIL 243
            ::..|.:|:|||||||:|| :..:..|.|:.|     .||||||||.|.|.:...||:|:.|||:
Human   135 ISASGQLKIADFGLARVFSPDGSRLYTHQVATSPLPRRWYRAPELLYGARQYDQGVDLWSVGCIM 199

  Fly   244 GELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQ---PYNNLTPKFHM 305
            ||||.|.||.||.::|.||..::.:||.|:..:||...:||.....:..:|   |...:.|.   
Human   200 GELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPD--- 261

  Fly   306 IGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHRNNAAPAPAVQPP-- 368
            :.....:||....:|.|..|..|.:.|..:||...|....|..:| .||.....||.....||  
Human   262 VSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELP-IPQRLGGPAPKAHPGPPHI 325

  Fly   369 ----ADIPISD-LLN 378
                .|.|:.: |||
Human   326 HDFHVDRPLEESLLN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 112/306 (37%)
S_TKc 53..337 CDD:214567 107/290 (37%)
CDK20XP_016870050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.