DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdk-1

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001022747.1 Gene:cdk-1 / 176374 WormBaseID:WBGene00000405 Length:332 Species:Caenorhabditis elegans


Alignment Length:300 Identity:119/300 - (39%)
Similarity:185/300 - (61%) Gaps:18/300 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVR 114
            :::|.||.::|||:||:||:.::.|:|.:||:||:|::.|.:|:|.:.:|||.:||:..|.|:|.
 Worm    19 LNDFTKLEKIGEGTYGVVYKGKNRRTNAMVAMKKIRLESEDEGVPSTAVREISLLKELQHPNVVG 83

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQ----PFTESEVKCITLQVLKALKYLHSRFMIH 175
            |..|::.:  :.:||:.:|...||...:|.:.:    |.  ..:|..|.|:|:|:.:.|.|.:||
 Worm    84 LEAVIMQE--NRLFLIFEFLSFDLKRYMDQLGKDEYLPL--ETLKSYTFQILQAMCFCHQRRVIH 144

  Fly   176 RDLKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFG 240
            ||||..|||:.:.|.||:|||||||....|.:..|.::|||||||||:|:|.:.::..||||:.|
 Worm   145 RDLKPQNLLVDNNGAIKLADFGLARAIGIPIRVYTHEVVTLWYRAPEILMGAQRYSMGVDMWSIG 209

  Fly   241 CILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAV--------QNFTLSQQPYN 297
            ||..|:...|||..|:|||.:|..|..:||.|:|..|.|...||..        :|| |..:.|:
 Worm   210 CIFAEMATKKPLFQGDSEIDELFRIFRVLGTPTELEWNGVESLPDYKATFPKWRENF-LRDKFYD 273

  Fly   298 NLTPKFHMIGQSGRNLLNILFIYNPKTRATAEECLKSKYF 337
            ..|.| |::..:..:||..|.||:|..|..|::.|...||
 Worm   274 KKTGK-HLLDDTAFSLLEGLLIYDPSLRLNAKKALVHPYF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 118/299 (39%)
S_TKc 53..337 CDD:214567 117/295 (40%)
cdk-1NP_001022747.1 PLN00009 19..315 CDD:177649 118/299 (39%)
STKc_CDK1_euk 21..312 CDD:270845 117/296 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.