DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdk-8

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_492357.2 Gene:cdk-8 / 172677 WormBaseID:WBGene00000409 Length:588 Species:Caenorhabditis elegans


Alignment Length:369 Identity:121/369 - (32%)
Similarity:182/369 - (49%) Gaps:64/369 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FEKLNRVGEGSYGIVYRARDTRS-----NEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENI 112
            ||....:|.|:||:||:|...:.     |:..|||.:    |..|..:|..|||.:.::..|.|:
 Worm    26 FENSKEIGRGTYGLVYKAVPKKQNGQFPNKEYALKMI----EGQGFSMSACREIALFRELRHPNL 86

  Fly   113 VRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTE--------SEVKCITLQVLKALKYLH 169
            :.|:.|.:... ..::|::|:.|.||..|:.:.....::        :.||.|..|:|..:.|||
 Worm    87 ICLQRVFLTNE-KKVWLLLDYAEHDLWHVIKHHRTAKSKKVPIMVPRNMVKNILFQILSGMHYLH 150

  Fly   170 SRFMIHRDLKVSN-LLMTD-----KGCIKVADFGLARMFSNPPKPMT---PQMVTLWYRAPELLL 225
            |.:::|||||.:| |||.|     :|.:|:||.|.:|:::||.|||.   |.:||.|||||||||
 Worm   151 SNWVLHRDLKPANILLMGDGPPDMRGRVKIADLGFSRIYANPLKPMAELDPVVVTFWYRAPELLL 215

  Fly   226 GCRTHTTAVDMWAFGCILGELLLGKPLLPGNSE---------IAQLDMIIDLLGAPSESIWPGFA 281
            |.:.:|.|:|:||.|||..|||..:||.....|         ..|:..|..|||.||::.||...
 Worm   216 GAKHYTKAIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDADWPDMK 280

  Fly   282 DLPAVQNFTLSQQPYNNLTP-------------KFHMIGQSG--RNLLNILFIYNPKTRATAEEC 331
            .:|..|.  |.....|..||             |:.:..||.  |.|:.:|.: :|..|.:.||.
 Worm   281 KMPDHQR--LLSDARNEGTPIQTFPNSLHRYFDKWKINSQSSPYRLLVKLLTV-DPTKRVSCEEA 342

  Fly   332 LKSKYF---VDPPQACDPGMMPTFP------QHRNNAAPAPAVQ 366
            :...||   ..||:..| .:...:|      :.:...||..|.|
 Worm   343 MNDIYFRKMERPPRETD-DVFNKYPIPYAKKEQQMTVAPDQAQQ 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 116/348 (33%)
S_TKc 53..337 CDD:214567 111/329 (34%)
cdk-8NP_492357.2 STKc_CDK8_like 26..348 CDD:270834 111/329 (34%)
S_TKc 26..348 CDD:214567 111/329 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.