DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdk-7

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001370652.1 Gene:cdk-7 / 171784 WormBaseID:WBGene00000408 Length:330 Species:Caenorhabditis elegans


Alignment Length:324 Identity:119/324 - (36%)
Similarity:188/324 - (58%) Gaps:14/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRM---DQEKDGLPISGLREIMILKQCHHENIVR 114
            ::.:..:|||.:..||.|:|..|.|.||:||:::   ::.|||:..:.:|||.:||:.||:||:.
 Worm     5 YDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLKEIHHDNIIG 69

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLK 179
            ||:|:..::  ||.||.||.:.||..|:.:.......:.:|.||:|:|..|::||..:::|||||
 Worm    70 LRDVIGHRT--SIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEFLHVHWILHRDLK 132

  Fly   180 VSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILG 244
            .:||||...|.:|:.||||||.|.:|.:..|.|:||.||||||||.|.|::...:|:|:.|||:.
 Worm   133 PNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIA 197

  Fly   245 ELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTL--SQQPYNNLTPKFHMIG 307
            ||||..|:.||.|:|.||..|.::||.|:...||...::   .::.:  .|..|..|...|....
 Worm   198 ELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEM---NSYVIIKPQTEYMALNYYFSAAP 259

  Fly   308 QSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMP----TFPQHRNNAAPAPAVQP 367
            |...:|:..::.::|..|.|..:.|:.:||...|..|....:|    ..||.|:........:|
 Worm   260 QDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEELPLPKKQQPQKRSRRLDDDGTRP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 115/308 (37%)
S_TKc 53..337 CDD:214567 110/288 (38%)
cdk-7NP_001370652.1 STKc_CDK7 4..302 CDD:270833 114/301 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.