DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and Cdk1

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_031685.2 Gene:Cdk1 / 12534 MGIID:88351 Length:297 Species:Mus musculus


Alignment Length:301 Identity:120/301 - (39%)
Similarity:184/301 - (61%) Gaps:23/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVR 114
            :.::.|:.::|||:||:||:.|...:.:|||:||:|::.|::|:|.:.:|||.:||:..|.|||.
Mouse     1 MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVS 65

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNM--SQPFTESEVKCITLQVLKALKYLHSRFMIHRD 177
            |::|::..|  .::|:.:|...||...||::  .|....|.||....|:|:.:.:.|||.::|||
Mouse    66 LQDVLMQDS--RLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRD 128

  Fly   178 LKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCI 242
            ||..|||:.|||.||:|||||||.|..|.:..|.::||||||:||:|||...::|.||:|:.|.|
Mouse   129 LKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTI 193

  Fly   243 LGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKF---- 303
            ..||...|||..|:|||.||..|...||.|:..:||....|          |.|.|..||:    
Mouse   194 FAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESL----------QDYKNTFPKWKPGS 248

  Fly   304 ---HM--IGQSGRNLLNILFIYNPKTRATAEECLKSKYFVD 339
               |:  :.::|.:||:.:.:|:|..|.:.:..||..||.|
Mouse   249 LASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 120/301 (40%)
S_TKc 53..337 CDD:214567 117/294 (40%)
Cdk1NP_031685.2 PLN00009 1..293 CDD:177649 120/301 (40%)
STKc_CDK1_euk 3..287 CDD:270845 117/295 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.