DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and cdk12

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_003200579.2 Gene:cdk12 / 100149834 ZFINID:ZDB-GENE-081104-294 Length:1293 Species:Danio rerio


Alignment Length:404 Identity:136/404 - (33%)
Similarity:217/404 - (53%) Gaps:60/404 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPAPDPQAPITRKGFLMSLNTGTPMPIPE------------------QNLFGRCRPVSEFEKLNR 58
            :|:| ||:|         .....|:..|.                  |..:|: |.|.:|:.:..
Zfish   627 DPSP-PQSP---------ARVSPPLLQPSFKKRPKICSPRYGERKQTQTDWGK-RCVDKFDIIGI 680

  Fly    59 VGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGK- 122
            :|||:||.||:|:|..:.|:|||||||:|.||:|.||:.:|||.||:|.:|.::|.::|:|..| 
Zfish   681 IGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSVVNMKEIVTDKQ 745

  Fly   123 -SLD------SIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKV 180
             :||      :.:||.::.:.||..:|::....|:...|:....|:::.|.|.|.:..:|||:|.
Zfish   746 DALDFKKDKGAFYLVFEYMDHDLMGLLESGLVSFSHEHVQSFMRQLMEGLDYCHKKNFLHRDIKC 810

  Fly   181 SNLLMTDKGCIKVADFGLARMF-SNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILG 244
            ||:|:.:.|.||:|||||||:: |...:|.|.:::|||||.||||||...::.|:|:|:.|||||
Zfish   811 SNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYSPAIDVWSCGCILG 875

  Fly   245 ELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKFHMIGQS 309
            ||...||:...|.|:.||::|..|.|:|..:.||....||........:|....|..:|..:...
Zfish   876 ELFTKKPIFQANQELLQLELISRLCGSPCPAAWPDVIRLPYFNTMRPKKQYRRRLREEFSFLPTP 940

  Fly   310 GRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHRNNAAPAPAVQPPADIP-I 373
            ..:||:.:...:|..|.|||:.|.|::..|    .:|..|                 ||.|:| .
Zfish   941 ALDLLDHMLTLDPSRRCTAEQALASQFLCD----VEPNKM-----------------PPPDLPHW 984

  Fly   374 SDLLNVFIKRQRME 387
            .|...::.|::|.:
Zfish   985 QDCHELWSKKRRRQ 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 121/316 (38%)
S_TKc 53..337 CDD:214567 115/292 (39%)
cdk12XP_003200579.2 STKc_CDK12 667..968 CDD:270847 118/301 (39%)
S_TKc 675..968 CDD:214567 115/292 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.