DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and CCDC32

DIOPT Version :10

Sequence 1:NP_523673.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001369371.1 Gene:CCDC32 / 90416 HGNCID:28295 Length:191 Species:Homo sapiens


Alignment Length:65 Identity:14/65 - (21%)
Similarity:33/65 - (50%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQ-LTHTTKHRWFPRARDRKAKQTPMD 120
            ||.: ||:..:::....:|:..:|..|..:.||..::::: |....|..|....:::.|.:..:|
Human    70 PLQD-SEVYLASLALLLSLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVD 133

  Fly   121  120
            Human   134  133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_523673.1 MRP-S32 30..121 CDD:462999 14/65 (22%)
CCDC32NP_001369371.1 CCDC32 17..172 CDD:464424 14/65 (22%)

Return to query results.
Submit another query.