DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and mrpl42

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001072400.1 Gene:mrpl42 / 779854 XenbaseID:XB-GENE-943761 Length:122 Species:Xenopus tropicalis


Alignment Length:93 Identity:38/93 - (40%)
Similarity:55/93 - (59%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQ 96
            :|:|.:|:|||.:||...||||:|.|||:...:.|.....|..||..:...|:| ||..::||.:
 Frog    31 LAMTSDGKTIVCYHPSVEVPYEHTKPLPQKDPLTSHTQTHELVLKARLNEVKAK-PEPTKEELSK 94

  Fly    97 LTHTTKHRWFPRA---RDRKAKQTPMDR 121
            :.:||||:|:|..   |.|..|..|.||
 Frog    95 MFYTTKHQWYPVGQYHRRRMKKDPPKDR 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 36/91 (40%)
mrpl42NP_001072400.1 MRP-S32 29..122 CDD:313441 36/91 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8947
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5098
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604174at2759
OrthoFinder 1 1.000 - - FOG0005205
OrthoInspector 1 1.000 - - oto105210
Panther 1 1.100 - - LDO PTHR13450
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3292
SonicParanoid 1 1.000 - - X4825
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.