DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and Mrpl42

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001346405.1 Gene:Mrpl42 / 67270 MGIID:1333774 Length:142 Species:Mus musculus


Alignment Length:95 Identity:35/95 - (36%)
Similarity:54/95 - (56%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVAR--QEL 94
            :|:|.:|||||.:||...:|||:|.|:|:...:.::....|..||..:...|||..|...  ::|
Mouse    48 LALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLEVRKSKQLEQGPMIEQL 112

  Fly    95 MQLTHTTKHRWFPRAR---DRKAKQTPMDR 121
            .::.:||||||:|..:   .||....|.||
Mouse   113 SKVFYTTKHRWYPHGQYHNRRKKLNPPRDR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 33/93 (35%)
Mrpl42NP_001346405.1 MRP-S32 46..142 CDD:402008 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9750
eggNOG 1 0.900 - - E1_KOG4106
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5331
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005205
OrthoInspector 1 1.000 - - oto95022
orthoMCL 1 0.900 - - OOG6_108519
Panther 1 1.100 - - LDO PTHR13450
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3292
SonicParanoid 1 1.000 - - X4825
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.