DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and mrpl42

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001314748.1 Gene:mrpl42 / 568235 ZFINID:ZDB-GENE-101014-1 Length:144 Species:Danio rerio


Alignment Length:124 Identity:49/124 - (39%)
Similarity:67/124 - (54%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FRLFSSSAVQRNAVGGKSL-----VEAVAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAV 69
            ||....|:|.::.|||.|:     || :|||.:|.|||.:||...||||.|.|:.....|...|.
Zfish    25 FRGLFLSSVSKSTVGGSSIHDDSNVE-IAVTSDGNTIVCFHPADDVPYELTQPIVRPDAISGHAE 88

  Fly    70 VKESALK----TAMRAFKSKHPEVARQELMQLTHTTKHRWFP--RARDRKAK-QTPMDR 121
            ..|..||    .|:.|.| |.|.:  :||.::.:||||||:|  :..:|:.| ..|.||
Zfish    89 THEQVLKDRLGKAVLADK-KAPTI--EELSKMFYTTKHRWYPVGQFHNRRRKLNPPKDR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 39/98 (40%)
mrpl42NP_001314748.1 MRP-S32 48..144 CDD:287214 39/99 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10721
eggNOG 1 0.900 - - E1_KOG4106
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604174at2759
OrthoFinder 1 1.000 - - FOG0005205
OrthoInspector 1 1.000 - - oto39472
orthoMCL 1 0.900 - - OOG6_108519
Panther 1 1.100 - - LDO PTHR13450
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3292
SonicParanoid 1 1.000 - - X4825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.