DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and mrpl-42

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_501580.3 Gene:mrpl-42 / 36805074 WormBaseID:WBGene00303009 Length:109 Species:Caenorhabditis elegans


Alignment Length:115 Identity:34/115 - (29%)
Similarity:52/115 - (45%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESA 74
            :|..||.:.::           |.|..|| ||.||||....|||:|.|:.     ..|...|:.:
 Worm    10 YRFASSDSPRK-----------VVVCANG-TIAAWHPPQHFPYEHTKPID-----LGSLTKKDQS 57

  Fly    75 LKTAMRAFKSKHP-EVARQELMQLTHTTKHRWFPRARDRKAKQ--TPMDR 121
            .:.:..|..|..| |....||..:.:|:||.|:.|.|:.:.:.  .|:.|
 Worm    58 SRLSAAAKASSIPREPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPR 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 30/94 (32%)
mrpl-42NP_501580.3 MRP-S32 20..92 CDD:287214 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8163
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005205
OrthoInspector 1 1.000 - - oto19284
orthoMCL 1 0.900 - - OOG6_108519
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3292
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.