DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and LOC367117

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001041384.1 Gene:LOC367117 / 367117 RGDID:1562651 Length:201 Species:Rattus norvegicus


Alignment Length:81 Identity:29/81 - (35%)
Similarity:48/81 - (59%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVA--RQEL 94
            :|:|.:|||||.:||...:||::|.|:|:...:.|:....|..|:|.:.. ..||.|..  .::|
  Rat    22 LALTYDGRTIVCYHPSVDIPYKHTKPIPQPDLLHSNEETHEQILRTKLEG-NRKHLEQGPMTEQL 85

  Fly    95 MQLTHTTKHRWFPRAR 110
            .::..||||||:|..:
  Rat    86 SKVFFTTKHRWYPHGQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 29/81 (36%)
LOC367117NP_001041384.1 MRP-S32 19..106 CDD:287214 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9786
eggNOG 1 0.900 - - E1_KOG4106
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604174at2759
OrthoFinder 1 1.000 - - FOG0005205
OrthoInspector 1 1.000 - - otm46269
orthoMCL 1 0.900 - - OOG6_108519
Panther 1 1.100 - - O PTHR13450
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4825
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.