DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and Ccdc32

DIOPT Version :10

Sequence 1:NP_523673.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001019416.1 Gene:Ccdc32 / 296081 RGDID:1307516 Length:179 Species:Rattus norvegicus


Alignment Length:109 Identity:21/109 - (19%)
Similarity:41/109 - (37%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKT 77
            ||.|.:..:..|..|:..|.:..:  ..:..|.|                 :..|.|...| |:.
  Rat    39 FSDSFMDSHPAGEGSMAAADSAVQ--PALKPWAP-----------------LHDSEVYLAS-LEK 83

  Fly    78 AMRAFKSKHPEVARQELMQ-LTHTTKHRWFPRARDRKAKQTPMD 120
            .:|..|..:.||..::::: |....|..|....:::.|.:..:|
  Rat    84 KLRRIKGLNEEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_523673.1 MRP-S32 30..121 CDD:462999 16/92 (17%)
Ccdc32NP_001019416.1 CCDC32 17..166 CDD:464424 21/109 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..179
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.