DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and MRPL42

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_054769.1 Gene:MRPL42 / 28977 HGNCID:14493 Length:142 Species:Homo sapiens


Alignment Length:95 Identity:35/95 - (36%)
Similarity:53/95 - (55%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVAR--QEL 94
            :|:|.:|||||.:||...:|||:|.|:|....:.::....:..|||.:.. |.:|.|...  ::|
Human    49 LALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEE-KVEHLEEGPMIEQL 112

  Fly    95 MQLTHTTKHRWFPRA---RDRKAKQTPMDR 121
            .::..||||||:|..   |.||....|.||
Human   113 SKMFFTTKHRWYPHGRYHRCRKNLNPPKDR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 33/93 (35%)
MRPL42NP_054769.1 MRP-S32 47..142 CDD:402008 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9998
eggNOG 1 0.900 - - E1_KOG4106
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604174at2759
OrthoFinder 1 1.000 - - FOG0005205
OrthoInspector 1 1.000 - - oto91441
orthoMCL 1 0.900 - - OOG6_108519
Panther 1 1.100 - - LDO PTHR13450
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3292
SonicParanoid 1 1.000 - - X4825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.