DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and Ccdc32

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_955014.2 Gene:Ccdc32 / 269336 MGIID:2685477 Length:179 Species:Mus musculus


Alignment Length:125 Identity:21/125 - (16%)
Similarity:43/125 - (34%) Gaps:44/125 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AVTKNGRTIVAWHPDTPVPYENTLPLPEISEI----------------QSSAVVKESALKTA--- 78
            :.||:||.:  |     ....:.||.|...::                :|.....:||::.|   
Mouse    10 SATKSGRDL--W-----AEICSCLPSPAQEDVSDNAFSDSFMDSHPAGESHTAAADSAVQPAGKP 67

  Fly    79 -----------------MRAFKSKHPEVARQELMQ-LTHTTKHRWFPRARDRKAKQTPMD 120
                             :|..|..:.||..::::: |....|..|....:::.|.:..:|
Mouse    68 WAPLHDSEVYLASLEKKLRRIKGLNEEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 21/125 (17%)
Ccdc32NP_955014.2 CCDC32 18..164 CDD:373451 17/117 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..65 3/28 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4106
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.