DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and lpl-1

DIOPT Version :9

Sequence 1:NP_001188899.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001335548.1 Gene:lpl-1 / 177729 WormBaseID:WBGene00003066 Length:250 Species:Caenorhabditis elegans


Alignment Length:49 Identity:11/49 - (22%)
Similarity:24/49 - (48%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ENTLPLPEISEIQSSAVVKE-SALKTAMRAFKSKHPEVARQELMQLTHT 100
            ::|:...::.:|...|.:|| ......::|.||:...:  ..::.|.||
 Worm    10 KSTVNAIDLGQISYGAALKEQQKYVDLVKANKSETHSL--NFILALEHT 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_001188899.1 MRP-S32 29..121 CDD:287214 11/49 (22%)
lpl-1NP_001335548.1 LipB 16..226 CDD:319743 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13450
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.