DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-N and NPP1

DIOPT Version :9

Sequence 1:NP_610549.1 Gene:PIG-N / 36049 FlyBaseID:FBgn0033479 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_009955.2 Gene:NPP1 / 850391 SGDID:S000000621 Length:742 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:53/259 - (20%)
Similarity:103/259 - (39%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLIVTDGFRADSFFEENCRYVPNLRKIFLREGVVGVSRT-----RVPTETRPGHITLIAGLYE-- 106
            ::|..|||......:.|..::.:|.:: ..:|.:.::.|     ..||||.|.|.||:.|.|.  
Yeast   171 IVISLDGFHPSLISKRNTPFLHDLYEL-KYDGGMNITSTPFMVPSFPTETFPNHWTLVTGQYPIH 234

  Fly   107 ---------DPS-------AVL--RGWKSNPIDFDTVFNRSSQTY--AWGANDVLNVFSHVSNGG 151
                     ||.       .||  |.|.:|  |.:.::    ||.  |:..:......:|:..|.
Yeast   235 HGIVSNVFWDPDLNEEFHPGVLDPRIWNNN--DTEPIW----QTVQSAFDGDIPFKAATHMWPGS 293

  Fly   152 EINLRFYNHD-----------LDFSPGY-DAYEEDEWVFKRVKLLLQQKREALQRAQNVVFFLHL 204
            ::|...||.:           .:.:|.| |.:...|.:.:::..:::....:....:..:...::
Yeast   294 DVNYTKYNEEKLQPEHKNPIARERTPFYFDEFNAKEPLSQKLSKIIEYVDMSTLNERPQLILGYV 358

  Fly   205 LGLDTAGHVHKPGAPK--------FRRTLEKTEKGVYAIYQEFERVFPDKRTAYLLTADHGMTD 260
            ..:|..||.|  |.|.        |..||.:.:..:..:.:..:.......|..::.:||||:|
Yeast   359 PNVDAFGHKH--GYPSESEYYYEDFTETLGEVDTFLKQLVESLQERNLTSFTNLVIVSDHGMSD 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-NNP_610549.1 Npp1 10..>265 CDD:224441 53/259 (20%)
GPI_EPT_1 42..335 CDD:293744 53/259 (20%)
PigN 421..834 CDD:282796
NPP1NP_009955.2 Phosphodiest 170..545 CDD:396300 53/259 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.