DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-N and ENPP5

DIOPT Version :9

Sequence 1:NP_610549.1 Gene:PIG-N / 36049 FlyBaseID:FBgn0033479 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001277001.1 Gene:ENPP5 / 59084 HGNCID:13717 Length:477 Species:Homo sapiens


Alignment Length:255 Identity:57/255 - (22%)
Similarity:98/255 - (38%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YGLEPPANRLVLIVTDGFRADSFFEENCRYVPNLRKIFLREGVVGVSRTRV-PTETRPGHITLIA 102
            :.|:|...:::|:..||||.|..::..   .|:...| ::.||.....|.| .|:|.|.|.||:.
Human    21 FSLQPDQQKVLLVSFDGFRWDYLYKVP---TPHFHYI-MKYGVHVKQVTNVFITKTYPNHYTLVT 81

  Fly   103 GLYEDPSAVLRGWKSNPIDFDTVFNRSSQTYAWGANDVLNVF------------------SHVSN 149
            ||:.:...::    :|.: ||.:.|:|...      |.:|::                  .|.|.
Human    82 GLFAENHGIV----ANDM-FDPIRNKSFSL------DHMNIYDSKFWEEATPIWITNQRAGHTSG 135

  Fly   150 GG-------EINLRFYNHDLDFSPGYDAYEEDEWVFKRVKLLLQ--QKREALQRAQNVVFFLHLL 205
            ..       :|:.||..|       |..|.|......||..:::  ..:|.:.           |
Human   136 AAMWPGTDVKIHKRFPTH-------YMPYNESVSFEDRVAKIIEWFTSKEPIN-----------L 182

  Fly   206 GL------DTAGHVHKPGAPKFRRTLEKTEKGVYAIYQEFERVFPDKRTAYLLTADHGMT 259
            ||      |..||...|.:|.....:...:|.:..:.|..::.........::|:|||||
Human   183 GLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-NNP_610549.1 Npp1 10..>265 CDD:224441 57/255 (22%)
GPI_EPT_1 42..335 CDD:293744 56/252 (22%)
PigN 421..834 CDD:282796
ENPP5NP_001277001.1 Phosphodiest 30..342 CDD:307681 55/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.