DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-N and Enpp3

DIOPT Version :9

Sequence 1:NP_610549.1 Gene:PIG-N / 36049 FlyBaseID:FBgn0033479 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_062243.2 Gene:Enpp3 / 54410 RGDID:708511 Length:875 Species:Rattus norvegicus


Alignment Length:247 Identity:52/247 - (21%)
Similarity:96/247 - (38%) Gaps:59/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EPPANRLVLIVTDGFRADSFFEENCRYVPNLRKIFLREGVVGV----SRTRVPTETRPGHITLIA 102
            :||   ::|...|||||: :.:.....:||:.|:    ...|:    .|...||:|.|.|.|::.
  Rat   159 QPP---VILFSMDGFRAE-YLQTWSTLLPNINKL----KTCGLHSKYMRAMYPTKTFPNHYTIVT 215

  Fly   103 GLYEDPSAVLRG-----------------------WKSNPIDFDTVF-NRSSQTYAWGANDVLNV 143
            |||.:...::..                       |...||....:: ...:.:|.|..:||   
  Rat   216 GLYPESHGIIDNNMYDVYLNKNFSLSSVEKSNPAWWSGQPIWLTAMYQGLKAASYYWPGSDV--- 277

  Fly   144 FSHVSNGGEINL-RFYNHDLDFSPGYDAYEEDEWVFKRVKLLLQQKREALQRAQNVVFF-LHLLG 206
               ..||...|: |.|::.:.:.             .|:..|||..  .|.:|:...|: :::..
  Rat   278 ---AVNGSFPNIYRNYSNSVPYE-------------SRIATLLQWL--DLPKAERPSFYTIYVEE 324

  Fly   207 LDTAGHVHKPGAPKFRRTLEKTEKGVYAIYQEFERVFPDKRTAYLLTADHGM 258
            .|:|||...|.:....:.|:..:.....:.:..::.........::.|||||
  Rat   325 PDSAGHKSGPVSAGVIKALQLVDDAFGMLMEGLKQRNLHNCVNIIVLADHGM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-NNP_610549.1 Npp1 10..>265 CDD:224441 52/247 (21%)
GPI_EPT_1 42..335 CDD:293744 52/247 (21%)
PigN 421..834 CDD:282796
Enpp3NP_062243.2 SO 51..94 CDD:197571
Cell attachment site. /evidence=ECO:0000255 79..81
SO 95..138 CDD:197571
Phosphodiesterase 141..510 52/247 (21%)
Phosphodiest 162..486 CDD:396300 50/241 (21%)
Nuclease 605..875
NUC 608..867 CDD:238043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.